PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI12G02660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 1011aa    MW: 111226 Da    PI: 7.3898
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI12G02660.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS307.23.8e-94344844374
             GRAS   4 lLlecAeavssgdlelaqalLarlsel..aspdg.dpmqRlaayfteALaarlarsvselykal.ppsetseknsseelaalklfsevsPilkf 93 
                      +LlecA +v++g +e+a+++Lar   l  a+ +g  p +Rla  ++  La+rl+r v+ + +al  ps     +  ++ aa++ f+e+sP++k+
  ORUFI12G02660.1  34 ALLECAAHVETGPMEKATRCLARATGLaaAAAAGdGPQKRLAEAMVDCLARRLLRPVQAITDALiDPSVYL--DRRSVRAARRGFFELSPFPKV 125
                      79*********************999965555564699**********************99995444443..34555578899********** PP

             GRAS  94 shltaNqaIleavegeervHiiDfd..isqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                      ++++ N+aI+eav++e+ vH++ ++   +q+ QW+ Ll++L  Rpegpp  +R+T+v++    + e l +++e L++ Aeel+++f+f+  v+ 
  ORUFI12G02660.1 126 AFVVGNRAIVEAVDNESLVHVVGMSgpFTQPCQWIQLLHELRRRPEGPPrVVRLTVVHD----DGELLAKMAEVLSDEAEELDMEFQFHG-VVG 214
                      ************************86679****************9988789*******....***************************.799 PP

             GRAS 185 rledleleeL....rvkpgEalaVnlvlqlhrll............................................................ 214
                      +ledl++++L    ++k+gEal+V++ lqlhrll                                                            
  ORUFI12G02660.1 215 QLEDLDFSNLrdvlEIKSGEALVVSCTLQLHRLLaadddamyssrsahlnqmasiaqlqqmavsscppstggggsvqykdddddpyrspatplt 308
                      9****9999876668999**************************************************************************** PP

             GRAS 215 .......desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl.eaklpres........eerikvErellgr 292
                               +++++ +  ++L++v+ lsPk+vvv+eq+adhn+ sF +rf+eal++y+a+fdsl +a ++++s        +er+ vEr+++g+
  ORUFI12G02660.1 309 fvsppasTPHLQMPAALANFLSAVRALSPKIVVVAEQDADHNGVSFRKRFCEALHHYAAVFDSLdDAAAATTSaashlwspDERAQVERVVVGE 402
                      *****87555555557778*********************************************766666666788899999************ PP

             GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      ei+ v+   ga+rrerh +l++W +r+e+aGF+ vpls+ a  + + ++r+++ +  +  e  g+l+l+W++rpL+s+SaWr
  ORUFI12G02660.1 403 EIKGVLLRDGAHRRERHDRLRQWAARMEMAGFTGVPLSYAAIRKGNDMVRRCGLRRCENRECGGCLLLCWSSRPLYSISAWR 484
                      *****************************************************887888899*******************8 PP

2GRAS205.62.9e-63582896102371
             GRAS 102 IleavegeervHiiDfdis..qGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                      I + + + + vHi+D++ s  ++ QW+ Ll+ +  Rp+g+p+l +T++++    +++ l e+++ L+k Ae+l+v+f+f   v  rle+l++++
  ORUFI12G02660.1 582 IRDVLVELQVVHIVDLSCSaaHPWQWLKLLDDFHGRPGGAPELYLTVLHD----DNDFLAEMQSLLSKKAESLEVSFRFIS-VIGRLETLDFSN 670
                      5566666789******8653389***************************....9**************************.799********* PP

             GRAS 194 Lrvkp....gEalaVnlvlqlhrll.........................................desvsleserdevLklvkslsPkvvvvv 242
                      Lr       g a+a++++lq+hrll                                           s  +++   ++L++++ l+P+++v++
  ORUFI12G02660.1 671 LRSTFqikfGVAVAISCALQMHRLLlvddnlsstsiaqlqkmanftqpkqmassvcspastlnylqTPSPRTPKLLARLLSAIRALKPNIMVIM 764
                      *54444555*******************************************************98666777778899**************** PP

             GRAS 243 eqeadhnsesFlerflealeyysalfdsleaklpres...eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplseka 333
                      eq+adhn+  F +rf e l+yy+alfd+++a ++++    +er  vEr++l++ei+n++ ceg +r erhe+l +W + +ee+GF++v+ls +a
  ORUFI12G02660.1 765 EQDADHNALLFRDRFNEVLNYYAALFDCFHAVAAANPgrtDERLRVERMILREEIKNILVCEGVHRHERHERLDQWAMHMEESGFHNVQLSFSA 858
                      *****************************77654444456****************************************************** PP

             GRAS 334 akqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                        + k  l  ++ +  + +e++g+l+l W + +L+s+S
  ORUFI12G02660.1 859 IREGKENLLSFGLKNCQNKEDRGCLLLSWGSTNLYSIS 896
                      ************888*********************98 PP

3GRAS91.91e-289011000278374
             GRAS  278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdg.yrveee..sgslvlgWkdrp 366 
                       ++ er+ vEr+llg+ei+ vvacegaer+erhe++++W +r+e+aG+++v ls++ a++a+ ll+ +++ g y+v ++   + ++++W++rp
  ORUFI12G02660.1  901 AAAERARVERVLLGEEIRGVVACEGAERTERHERARQWAARMEAAGMESVGLSYSGAMEARKLLQSCGWVGpYEVRHDagGHGFFFCWHKRP 992 
                       5689****************************************************************6666****884345678******* PP

             GRAS  367 LvsvSaWr 374 
                       L++v+aWr
  ORUFI12G02660.1  993 LYAVTAWR 1000
                       *******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.4665464IPR005202Transcription factor GRAS
PfamPF035141.3E-9134484IPR005202Transcription factor GRAS
PfamPF035141.0E-60582896IPR005202Transcription factor GRAS
PROSITE profilePS5098526.908582879IPR005202Transcription factor GRAS
PfamPF035143.6E-269011000IPR005202Transcription factor GRAS
PROSITE profilePS509858.834904977IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 1011 aa     Download sequence    Send to blast
MFSGTDSSSP ELSLCSPYEP WTQGRGPTEE LGLALLECAA HVETGPMEKA TRCLARATGL  60
AAAAAAGDGP QKRLAEAMVD CLARRLLRPV QAITDALIDP SVYLDRRSVR AARRGFFELS  120
PFPKVAFVVG NRAIVEAVDN ESLVHVVGMS GPFTQPCQWI QLLHELRRRP EGPPRVVRLT  180
VVHDDGELLA KMAEVLSDEA EELDMEFQFH GVVGQLEDLD FSNLRDVLEI KSGEALVVSC  240
TLQLHRLLAA DDDAMYSSRS AHLNQMASIA QLQQMAVSSC PPSTGGGGSV QYKDDDDDPY  300
RSPATPLTFV SPPASTPHLQ MPAALANFLS AVRALSPKIV VVAEQDADHN GVSFRKRFCE  360
ALHHYAAVFD SLDDAAAATT SAASHLWSPD ERAQVERVVV GEEIKGVLLR DGAHRRERHD  420
RLRQWAARME MAGFTGVPLS YAAIRKGNDM VRRCGLRRCE NRECGGCLLL CWSSRPLYSI  480
SAWRPAASGG AGSGSERSDP HTDPPCRVGR SAAAAAMSAS LHRPALASLL QIEAGGCGVL  540
GVFAPGPRLP CRGYHPCRSS SILGSASLTP RRRHISPSGL RIRDVLVELQ VVHIVDLSCS  600
AAHPWQWLKL LDDFHGRPGG APELYLTVLH DDNDFLAEMQ SLLSKKAESL EVSFRFISVI  660
GRLETLDFSN LRSTFQIKFG VAVAISCALQ MHRLLLVDDN LSSTSIAQLQ KMANFTQPKQ  720
MASSVCSPAS TLNYLQTPSP RTPKLLARLL SAIRALKPNI MVIMEQDADH NALLFRDRFN  780
EVLNYYAALF DCFHAVAAAN PGRTDERLRV ERMILREEIK NILVCEGVHR HERHERLDQW  840
AMHMEESGFH NVQLSFSAIR EGKENLLSFG LKNCQNKEDR GCLLLSWGST NLYSISRSAA  900
AAAERARVER VLLGEEIRGV VACEGAERTE RHERARQWAA RMEAAGMESV GLSYSGAMEA  960
RKLLQSCGWV GPYEVRHDAG GHGFFFCWHK RPLYAVTAWR PAASRRGHTR S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-13344847375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL9351540.0AL935154.2 Oryza sativa chromosome 12, . BAC OSJNBb0109O08 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619131.10.0PREDICTED: scarecrow-like protein 3
TrEMBLA0A0E0RDI90.0A0A0E0RDI9_ORYRU; Uncharacterized protein
STRINGBGIOSGA034521-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.14e-70scarecrow-like 3